PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g08177.2.p
Common NameBRADI_2g08177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 662aa    MW: 72723.3 Da    PI: 6.3966
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g08177.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.4e-29595646152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Bradi2g08177.2.p 595 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 646
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.824585661IPR003035RWP-RK domain
PfamPF020422.2E-26598646IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MDIDPSSASH ADGGASDMWP FDSLTTSLFF SSVSSSPPPL TTLPVASSSW LAPPSPLWLF  60
DDRQLLPIEV GPPPVSAAAE NAAVAAAAAA AAAAEDVQRA RSGNSDTASK RVERLNNNKW  120
QIHLSLHDDS TNSSCLFKEK LTHALRYFKE STDQHLLVQV WAPVKSGDRY VLTTSGQPFV  180
LDHQSIGLLQ YRAVSMMYMF SIDGDNAGEL GLPGRVYKQK VPEWTPNVQY YSSTEYPRLN  240
HAISYNVHGT VALPVFDPSV QSCIAVVELI MTSKKINYAD EVDKVCKALE AVNLKSTEIL  300
DHPNVQICNE GRQSALVEIL EILTVVCEEH KLPLAQTWVP CKYRSVLAHG GGVKKSCLSF  360
DGSCMGEVCM STSDVAFHVI DAHMWGFRDA CIEHHLQKGQ GVSGKAFIYH RPCFSKDISQ  420
FCKVEYPLVH YARMFGLAGC FAVCLQSPYT GDDYYILEFF LPPSCRDEDD QNALLESILG  480
LINQCLRNLK VADNGASNEA SLQLSNVLII ENEDFKTTGH FGNSEGCFRE SPEDDTNGVH  540
EFDKGNNKVS EGHVLADDNS QNNGTSVSRP NGSGASDSSL LHKSNKQPER RRGKAEKTIS  600
LEVLQQYFSG SLKNAAKSLG VCPTTMKRIC RQHGISRWPS RKINKVLFLL FLLALHQILS  660
I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0Q3JYC70.0A0A0Q3JYC7_BRADI; Uncharacterized protein
STRINGBRADI2G08177.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein